PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA81G00050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family HRT-like
Protein Properties Length: 643aa    MW: 73006.3 Da    PI: 8.6812
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA81G00050genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like581.6e-18445475131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGv+ledG++C+++Pvk+RKRC eHKG+Ri
  AA81G00050 445 VCGVLLEDGTTCSTTPVKERKRCTEHKGQRI 475
                 7*****************************7 PP

2HRT-like48.21.8e-15499529131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 iCGvil    +C+r+Pv gRKRCeeHKGmRi
  AA81G00050 499 ICGVILPYMEPCRRKPVLGRKRCEEHKGMRI 529
                 8*****************************7 PP

3HRT-like24.35.4e-08567594128
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKG 28 
                 +C +i++ Gs+C+r++  g  RC++HK 
  AA81G00050 567 VCEAITKKGSPCTRNAPNGSRRCWQHKE 594
                 6**************************6 PP

4HRT-like58.97.9e-19611641131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 iC v+l +GsvC+++PvkgRKRCeeHKGmRi
  AA81G00050 611 ICSVKLYNGSVCEKSPVKGRKRCEEHKGMRI 641
                 8*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5135211.8464195IPR013766Thioredoxin domain
SuperFamilySSF528336.53E-2773194IPR012336Thioredoxin-like fold
Gene3DG3DSA:3.40.30.102.8E-2482191IPR012336Thioredoxin-like fold
PfamPF000853.8E-1893188IPR013766Thioredoxin domain
CDDcd029474.69E-2395191No hitNo description
PROSITE patternPS001940110128IPR017937Thioredoxin, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045454Biological Processcell redox homeostasis
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MSPTPTTSFR SLRFSSPISP RFRLQPYRNS DERLYSLPFS SFSSSSSISH ENTIFSASKQ  60
YLSMKVQATG AETEQPKWWE KKAGLNNMID IKSTEQFLNT LKEAEDRLVI VDFYGTWCAS  120
CRAMFPKLCK TAEEHPEILF LKVNFDENKS LCKSLNVKVL PYFHFYRGAN GQIESFSCSL  180
AKFRKLRDAI ERHKGESCSD LSSEKVEEDS TDFGDGDLFD MFRRDDYIRN KHDAVFSNWQ  240
GFTRSMLLRN PFSETAEFRR NLVDYSSISR DLGPPKVVMG AIDREENFRK SKTSVGSFRI  300
QGLPSTSFPG LSELGAALIS HEQAQKVDAN ESLVNRLGQR VSIRSQLQRY GRSTAHLSNV  360
NLTSDNKATD HLNPKDCKTN EFPVKKASDQ KKNGDIIKDK RHVLAEEMEI NCDAAEEKSY  420
FLESVLKLSD SERHDDIDGS DSSSVCGVLL EDGTTCSTTP VKERKRCTEH KGQRICGLKQ  480
IPHDNISTSR RQYKDTDNIC GVILPYMEPC RRKPVLGRKR CEEHKGMRIN AFSFLINFIK  540
TDKTVKEEDK SESATHTDMK QEAPGHVCEA ITKKGSPCTR NAPNGSRRCW QHKEKPFEEK  600
SSQNVQSGTS ICSVKLYNGS VCEKSPVKGR KRCEEHKGMR ITS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zzx_A5e-15911945105THIOREDOXIN
3zzx_B5e-15911945105THIOREDOXIN
4aj6_A5e-15911945105THIOREDOXIN
4aj6_B5e-15911945105THIOREDOXIN
4aj7_A5e-15911945105THIOREDOXIN
4aj7_B5e-15911945105THIOREDOXIN
4aj8_A5e-15911945105THIOREDOXIN
4aj8_B5e-15911945105THIOREDOXIN
4v2l_A5e-15911945105THIOREDOXIN
4v2l_B5e-15911945105THIOREDOXIN
4v2m_A5e-15911945105THIOREDOXIN
4v2m_B5e-15911945105THIOREDOXIN
4v2n_A5e-15911945105THIOREDOXIN
4v2n_B5e-15911945105THIOREDOXIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002869624.11e-141hypothetical protein ARALYDRAFT_913945
SwissprotA2RQG71e-123ET_BRANA; Protein EFFECTOR OF TRANSCRIPTION
TrEMBLD7MFC21e-141D7MFC2_ARALL; Putative uncharacterized protein
STRINGscaffold_701687.11e-141(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26170.11e-93